"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q0SZK3"	"{'domain_architectures': 20829, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 20829}"	"['Sulfur carrier protein involved in sulfur trafficking in the cell. Part of a sulfur-relay system required for 2-thiolation during synthesis of 2-thiouridine of the modified wobble base 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) in tRNA. Interacts with IscS and stimulates its cysteine desulfurase activity. Accepts an activated sulfur from IscS, which is then transferred to TusD, and thus determines the direction of sulfur flow from IscS to 2-thiouridine formation. Also appears to be involved in sulfur transfer for the biosynthesis of molybdopterin']"	"tusA"	"[{'identifier': 'GO:0097163', 'name': 'sulfur carrier activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0002143', 'name': 'tRNA wobble position uridine thiolation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"TUSA_SHIF8"	"be88bee338af40a52f33520c9062dad4cf0cb53e"	True	False	False	81	"Sulfur carrier protein TusA"	3	""	"MTDLFSSPDHTLDALGLRCPEPVMMVRKTVRNMQPGETLLIIADDPATTRDIPGFCTFMEHELVAKETDGLPYRYLIRKGG"	"reviewed"	"{'taxId': '373384', 'scientificName': 'Shigella flexneri serotype 5b (strain 8401)', 'fullName': 'Shigella flexneri serotype 5b (strain 8401)'}"
