"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P60983"	"{'domain_architectures': 20829, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'smart': 1, 'pirsf': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 20829}"	"['This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells']"	"GMFB"	"[{'identifier': 'GO:0003779', 'name': 'actin binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0071933', 'name': 'Arp2/3 complex binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0071846', 'name': 'actin filament debranching', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"GMFB_HUMAN"	"46dd605d1b0837fadd9088620535096e142553f0"	True	False	False	142	"Glia maturation factor beta"	1	"UP000005640"	"MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH"	"reviewed"	"{'taxId': '9606', 'scientificName': 'Homo sapiens', 'fullName': 'Homo sapiens (Human)'}"