"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P52870"	"{'domain_architectures': 5456, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 14, 'taxa': 1, 'dbEntries': {'pirsf': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5456}"	"['Part of the Sec61 complex, which is the major component of a channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). The functional states of the translocon complex include co- and post-translational ER import, cotranslational membrane protein integration and retrograde transport of misfolded proteins out of the ER. In the cotranslational pathway, ribosomes synthesizing presecretory proteins are targeted to the translocon by the cytosolic signal recognition particle (SRP) and its ER-localized receptor. The association of the Sec61 complex with the ribosome is mediated by the 28S rRNA of the large ribosomal subunit. SRP-independent post-translational translocation requires the association of additional factors, such as the Sec62/63 complex and KAR2']"	"SBH1"	"[{'identifier': 'GO:0006886', 'name': 'intracellular protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005784', 'name': 'Sec61 translocon complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"SC6B1_YEAST"	"c2d69841fb38869543a543c43fb8cffe971b5be1"	True	False	False	82	"Protein transport protein SBH1"	1	"UP000002311"	"MSSPTPPGGQRTLQKRKQGSSQKVAASAPKKNTNSNNSILKIYSDEATGLRVDPLVVLFLAVGFIFSVVALHVISKVAGKLF"	"reviewed"	"{'taxId': '559292', 'scientificName': 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)', 'fullName': ""Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)""}"
