"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P51932"	"{'domain_architectures': 93545, 'entries': 5, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'prosite': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 93545}"	"['Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)']"	"mt:ND1"	"[{'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"NU1M_DROMD"	"864b30094953a8b5e4deba394bc1ff33053fe7c1"	True	False	True	163	"NADH-ubiquinone oxidoreductase chain 1"	3	""	"MEFILSLIGSLLLIICVLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYISPIFSLFLSLFVWMCMPFFVKLYSFNLGGLFFLCCTSLGVYTVMVAGWSSNSNYALLGGLRAVAQTISYEVSLALIGFKILLFSLL"	"reviewed"	"{'taxId': '30013', 'scientificName': 'Drosophila madeirensis', 'fullName': 'Drosophila madeirensis (Fruit fly)'}"