"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P0AEK4"	"{'domain_architectures': 518272, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 23, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'pfam': 1, 'pirsf': 1, 'ncbifam': 1, 'panther': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 518272}"	"['Catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). Involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis']"	"fabI"	"[{'identifier': 'GO:0004318', 'name': 'enoyl-[acyl-carrier-protein] reductase (NADH) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006633', 'name': 'fatty acid biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"FABI_ECOLI"	"ff1cec7cb7eee88f7c3ec2b2277c3a1762c3bf68"	True	False	False	262	"Enoyl-[acyl-carrier-protein] reductase [NADH] FabI"	1	"UP000000625"	"MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK"	"reviewed"	"{'taxId': '83333', 'scientificName': 'Escherichia coli (strain K12)', 'fullName': 'Escherichia coli (strain K12)'}"
