"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P0ABA8"	"{'domain_architectures': 32814, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'ssf': 1, 'pfam': 1, 'cathgene3d': 2, 'panther': 1, 'ncbifam': 2, 'hamap': 1, 'prints': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 32814}"	"['Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex (By similarity)']"	"atpG"	"[{'identifier': 'GO:0046933', 'name': 'proton-transporting ATP synthase activity, rotational mechanism', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015986', 'name': 'proton motive force-driven ATP synthesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0045259', 'name': 'proton-transporting ATP synthase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"ATPG_ECO57"	"5065c0b8ee2d81b78d885ed166ad0e843e71652a"	True	False	False	287	"ATP synthase gamma chain"	3	"UP000000558"	"MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNLEYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPASDDDDLKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGAAAV"	"reviewed"	"{'taxId': '83334', 'scientificName': 'Escherichia coli O157:H7', 'fullName': 'Escherichia coli O157:H7'}"
