"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P0A3Y1"	"{'domain_architectures': 917, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 3, 'taxa': 1, 'dbEntries': {'ssf': 1, 'hamap': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 917}"	"['Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions']"	"petM"	"[{'identifier': 'GO:0009512', 'name': 'cytochrome b6f complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"PETM_NOSS1"	"b027d5f887b3f82938f80885b924737dd53de9a9"	True	False	34	"Cytochrome b6-f complex subunit 7"	1	"UP000002483"	"MSGELLNAALLSFGLIFVGWALGALLLKIQGAEE"	"reviewed"	"{'taxId': '103690', 'scientificName': 'Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)', 'fullName': 'Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)'}"