"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"O31697"	"{'domain_architectures': 148, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 1, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 148}"	"[""Antirepressor protein that regulates the activity of the global regulator AbrB (PubMed:18840696). Acts by binding to AbrB, thereby blocking AbrB's ability to bind to DNA (PubMed:18840696). It acts as a direct DNA mimic (PubMed:24534728). AbbA itself does not bind to DNA (PubMed:18840696)""]"	"abbA"	""	"ABBA_BACSU"	"e68044b2c90fa8deba239d215027a9c65c3915f6"	True	False	65	"Antirepressor protein AbbA"	1	"UP000001570"	"MRMSLIGERFTEEEQKLLLNILINHEYAIELLSSEINDIETGTKNVDGTTYKKLVTLYDRFRFEN"	"reviewed"	"{'taxId': '224308', 'scientificName': 'Bacillus subtilis (strain 168)', 'fullName': 'Bacillus subtilis (strain 168)'}"