"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"X5CUL6"	"{'domain_architectures': 13116, 'entries': 4, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'hamap': 1, 'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 13116}"	"['Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetL is important for photoautotrophic growth as well as for electron transfer efficiency and stability of the cytochrome b6-f complex']"	"petL"	"[{'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009512', 'name': 'cytochrome b6f complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"X5CUL6_MAGTR"	"b1ec384e42f4ea94f941cc04be64ce61cc8ad746"	True	False	False	31	"Cytochrome b6-f complex subunit 6"	3	""	"MPTITSYFGFLLAASTITPALLIGLSKIRLI"	"unreviewed"	"{'taxId': '44926', 'scientificName': 'Magnolia tripetala', 'fullName': 'Magnolia tripetala (Umbrella-tree)'}"
