"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"X5CLZ5"	"{'domain_architectures': 64325, 'entries': 3, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 64325}"	"['Forms a proton-selective ion channel that is necessary for the efficient release of the viral genome during virus entry']"	"M2"	"[{'identifier': 'GO:0015078', 'name': 'proton transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:1902600', 'name': 'proton transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0033644', 'name': 'host cell membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0055036', 'name': 'virion membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"X5CLZ5_9INFA"	"e6d923ab963dc33a4b3f474023342d9fc49fd6e6"	False	False	False	96	"Matrix protein 2"	3	""	"MIFLKICRPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLKRGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE"	"unreviewed"	"{'taxId': '1476435', 'scientificName': 'Influenza A virus (A/pigeon/Anhui/08/2013(H3N8))', 'fullName': 'Influenza A virus (A/pigeon/Anhui/08/2013(H3N8))'}"