"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"W6QDN7"	"{'domain_architectures': 7403, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7403}"	"['Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF1']"	"acn9"	"[{'identifier': 'GO:0034553', 'name': 'mitochondrial respiratory chain complex II assembly', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005739', 'name': 'mitochondrion', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"W6QDN7_PENRF"	"279d9d6b53624452bcf3c13efe7dd7f45beefd56"	True	False	False	130	"Succinate dehydrogenase assembly factor 3"	3	"UP000030686"	"MRIAQRLFMAMPASIGSKSSLSEALALLPPLQLYRRILRVHRKLDPEMRVLGDSYVKNEFRAHRSVENPLHIIGFLTEWQLYAQKLEGDSWAGDKLDKAKLDKMSDQQLGQLLELMQALRNEGEGEGEGQ"	"unreviewed"	"{'taxId': '1365484', 'scientificName': 'Penicillium roqueforti (strain FM164)', 'fullName': 'Penicillium roqueforti (strain FM164)'}"
