"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"W6N2P6"	"{'domain_architectures': 29175, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'hamap': 1, 'pfam': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 29175}"	"['This is one of the proteins that bind and probably mediate the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance']"	"rplR"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"W6N2P6_CLOTY"	"b102799002328006c5dbab7bae3b4802073da4c3"	True	False	False	119	"Large ribosomal subunit protein uL18"	3	"UP000019482"	"MFKKDDKKKLRKKRHLRVRKKIFGTSEIPRLAVYRSEKNIYAQVIDDIEGTTLVSASSLDKDFEGIGSNKEAAKVIGGIIAKRAIEKGINKVVFDRGGYIYHGRIQNLAEGAREAGLKF"	"unreviewed"	"{'taxId': '1408889', 'scientificName': 'Clostridium tyrobutyricum DIVETGP', 'fullName': 'Clostridium tyrobutyricum DIVETGP'}"
