General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W5JVB3",
        "id": "W5JVB3_ANODA",
        "source_organism": {
            "taxId": "43151",
            "scientificName": "Anopheles darlingi",
            "fullName": "Anopheles darlingi (Mosquito)"
        },
        "name": "MICOS complex subunit MIC13",
        "description": [
            "Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane"
        ],
        "length": 122,
        "sequence": "MFRFAIKTGIAGGAVYYSKEEGIWNEDTEKVYERYAAALHPHVQSLKQQIPLDIPALPSSGEMCFVTKHYYNEGVKNTIHFIHRLPCYAGQWAKKGSDAIKKALDAPSAPATPAAVEPQAKK",
        "proteome": "UP000000673",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "3fcb16c0ca25f32b2fe166eba970715da7fd3ced",
        "counters": {
            "domain_architectures": 1473,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1473
        }
    }
}