"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"W0TG88"	"{'domain_architectures': 72767, 'entries': 16, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 3, 'cathgene3d': 1, 'pfam': 1, 'profile': 1, 'ssf': 1, 'ncbifam': 1, 'cdd': 1, 'panther': 1, 'prints': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 72767}"	"['GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus', 'GTP-binding protein involved in protein trafficking; modulates vesicle budding and uncoating within the Golgi apparatus']"	"ARF1"	"[{'identifier': 'GO:0003924', 'name': 'GTPase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005525', 'name': 'GTP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"W0TG88_KLUMD"	"d6bc1331c4b416e231f52943c4822a3a2b702855"	True	False	False	181	"ADP-ribosylation factor"	3	""	"MGVSFSKLFSNLFGHKEMRILMVGLDGAGKTTVLYKLKLGEVVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRARIAEAREVLQRMLNEDEIRNAVLLVFANKQDLPEAMPAAEITEKLGLHSIRQRPWYIQATCATSGEGLYEGLEWLSTTLKNQS"	"unreviewed"	"{'taxId': '1003335', 'scientificName': 'Kluyveromyces marxianus (strain DMKU3-1042 / BCC 29191 / NBRC 104275)', 'fullName': 'Kluyveromyces marxianus (strain DMKU3-1042 / BCC 29191 / NBRC 104275) (Yeast)'}"
