"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"U7Q7T7"	"{'domain_architectures': 16386, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'profile': 1, 'ncbifam': 1, 'pirsf': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 16386}"	"['Additional factor that functions in concert with eIF-2 and the initiator tRNA in directing the ribosome to the proper start site of translation']"	"HMPREF1624_01415"	"[{'identifier': 'GO:0003743', 'name': 'translation initiation factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006413', 'name': 'translational initiation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"U7Q7T7_SPOS1"	"1c85f241b778189fd9a754044a87eb621166ad3c"	True	False	False	118	"SUI1 domain-containing protein"	3	"UP000018087"	"MSIENLKINDPFADADEDTGQSQAKQQEYLHIRIQQRNGRKTLTTVQGIPPKFDHKKILKVIKKEFACNGTIISAAESKGMGEVIQLQGDQRSKIRDFLIDKATGLGLDEKTIKVHGF"	"unreviewed"	"{'taxId': '1391915', 'scientificName': 'Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183)', 'fullName': ""Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) (Rose-picker's disease fungus)""}"
