"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"U5J416"	"{'domain_architectures': 5960, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 2, 'pfam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 5960}"	"['RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate in the photorespiration process. Both reactions occur simultaneously and in competition at the same active site']"	"rbcL"	"[{'identifier': 'GO:0016984', 'name': 'ribulose-bisphosphate carboxylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015977', 'name': 'carbon fixation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0000287', 'name': 'magnesium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"U5J416_KALPR"	"4d0b693a5d3946089f4c4facbe3b8395431c8146"	True	False	True	150	"Ribulose bisphosphate carboxylase large chain"	3	""	"LTYYTPNYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGDDNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLG"	"unreviewed"	"{'taxId': '45912', 'scientificName': 'Kalmia procumbens', 'fullName': 'Kalmia procumbens (Alpine azalea)'}"
