General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "T0CUB8",
        "id": "TCSR3_PARS9",
        "source_organism": {
            "taxId": "1292036",
            "scientificName": "Paraclostridium sordellii (strain ATCC 9714 / DSM 2141 / JCM 3814 / CCUG 9284 / LMG 15708 / NCIMB 10717 / 211)",
            "fullName": "Paraclostridium sordellii (strain ATCC 9714 / DSM 2141 / JCM 3814 / CCUG 9284 / LMG 15708 / NCIMB 10717 / 211)"
        },
        "name": "RNA polymerase sigma factor TcsR",
        "description": [
            "Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released (Probable). Transcriptional regulator specifically required to activate expression of the toxin gene locus, composed of tcsL and tcdE/utxA (PubMed:23873908)"
        ],
        "length": 170,
        "sequence": "MSNLYESIRKYKCGYIEEILNILDMFDPLLNKFQRNSCYEDMKSELSLFMFNLIDNFPLEKDCFKEDKFIINYIYKSLKNKFIQVNKLHQKVKSYETNIDIIWVNNCDYANLLSTVIFEDIIKDLTQNEKNILRKIYLHGLRESEISRELNISRQAVNKTHLRALEKLKN",
        "proteome": null,
        "gene": "tcsR",
        "go_terms": [
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006352",
                "name": "DNA-templated transcription initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "4f217bcdb010f4aecbddbcfd94caedefa08d93f7",
        "counters": {
            "domain_architectures": 5664,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5664
        }
    }
}