"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"S9X081"	"{'domain_architectures': 3149, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3149}"	"['Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The complex plays an important role in the uptake of multiple carbon sources present in different host niches']"	"SPOG_01108"	"[{'identifier': 'GO:0006122', 'name': 'mitochondrial electron transport, ubiquinol to cytochrome c', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0045275', 'name': 'respiratory chain complex III', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"S9X081_SCHCR"	"9f40e9dec049e1a8dfafddc21aa8555647e7b8a4"	True	False	False	93	"Cytochrome b-c1 complex subunit 8"	3	"UP000015464"	"MGGAPSGKTYLGWWGHLGGPKQKGIITYTLSPFQQKPMAGFLTSSFRNTFRRALNEGLYVAIPFGVAYYIYCWGKERNEFLNSKWGRHLVAEE"	"unreviewed"	"{'taxId': '653667', 'scientificName': 'Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691)', 'fullName': 'Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691) (Fission yeast)'}"
