"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"S6A7X3"	"{'domain_architectures': 32187, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'pfam': 1, 'ncbifam': 1, 'panther': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 32187}"	"['Phosphorylation of dTMP to form dTDP in both de novo and salvage pathways of dTTP synthesis']"	"tmk"	"[{'identifier': 'GO:0004798', 'name': 'dTMP kinase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006233', 'name': 'dTDP biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"S6A7X3_9SPIR"	"a59df233a55cde1fe7baaeb02b03a5d0cb818791"	True	False	False	209	"Thymidylate kinase"	3	"UP000015620"	"MLLSNFIVFEGIDGTGTTSQLRLLKERFASEGKEETCLFTQEPTTGKIGTLIRSALQGGFKLAPETMTRLFAADRCEHLYGEGGIIEDLNAGKAVFSDRYIFSSLAYQAAAGAKELAEAQNRGFPMPEYLFFFDLPVNISMSRVIGRSNVLEIYEEESFQNKVRNEYLNILEVFKKQEPNMQIIKINASETIEEIHSKLWSILKDLPKI"	"unreviewed"	"{'taxId': '1291379', 'scientificName': 'Treponema pedis str. T A4', 'fullName': 'Treponema pedis str. T A4'}"