"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"S5VT27"	"{'domain_architectures': 65483, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 65483}"	"['NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient']"	"nuoA"	"[{'identifier': 'GO:0016651', 'name': 'oxidoreductase activity, acting on NAD(P)H', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"S5VT27_STRC3"	"e9a5b42e32de65bd6bc464b4186c01128f5abeb7"	True	False	False	119	"NADH-quinone oxidoreductase subunit A"	3	"UP000015423"	"MNAYAPILVLGALGAGFAIFSVVMATLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIKYYLTAMLFIVFDIEIVFLYPWAVTFDALGVFGLVEMLLFVLTVFVAYAYVWRRGGLEWD"	"unreviewed"	"{'taxId': '1214242', 'scientificName': 'Streptomyces collinus (strain DSM 40733 / Tue 365)', 'fullName': 'Streptomyces collinus (strain DSM 40733 / Tue 365)'}"