"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"S4R2Z8"	"{'domain_architectures': 394800, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'prints': 3, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 394800}"	"['Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase']"	"ADORA2A"	"[{'identifier': 'GO:0004930', 'name': 'G protein-coupled receptor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0007186', 'name': 'G protein-coupled receptor signaling pathway', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0001609', 'name': 'G protein-coupled adenosine receptor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0001973', 'name': 'G protein-coupled adenosine receptor signaling pathway', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"S4R2Z8_HUMAN"	"587fa3dbe4504dc051049f3cca904dd9ab631b87"	True	False	True	108	"Adenosine receptor A2"	3	"UP000005640"	"MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRI"	"unreviewed"	"{'taxId': '9606', 'scientificName': 'Homo sapiens', 'fullName': 'Homo sapiens (Human)'}"
