HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "R7ZLP9",
"id": "R7ZLP9_9BACT",
"source_organism": {
"taxId": "1232681",
"scientificName": "Lunatimonas lonarensis",
"fullName": "Lunatimonas lonarensis"
},
"name": "2-amino-3-ketobutyrate coenzyme A ligase",
"description": [
"Catalyzes the cleavage of 2-amino-3-ketobutyrate to glycine and acetyl-CoA",
"Involved in de novo bacterial ceramide synthesis. Catalyzes the condensation of L-serine with palmitoyl-CoA (hexadecanoyl-CoA) to produce 3-oxosphinganine. Also capable of using alanine as substrate leading to the formation of 1-deoxysphinganine (1-deoxySa). Contributes to the levels of endogenous sphingolipids in its host"
],
"length": 398,
"sequence": "MYDRLKPSLISELEDIQSAGLFKRERIILSPQGAEILVEGGKTVLNFCANNYLGLSSHPAVIEAAKQAIDSHGFGMSSVRFICGTQDIHKVLEQKISDFLGTEDTILYAAAFDANGGVFEPLFGPEDAIISDTLNHASIIDGVRLCKAMRFRYAHNDMADLERQLQEAVAKGAKQRIIVTDGVFSMDGTIAQLDKIVALAEKYEALVMSDECHSTGFVGKTGRGVHELTGVMGKLDIITGTLGKALGGASGGFTSGRKEIIELLRQRSRPYLFSNTLAPAIVGASNAVFDLLAASTDLRDKLEQNTLYFREQMTAAGFDIKPGIHPIVPIMLYDAALSQRMAEKLLEKGVYVIGFYYPVVPKGQARIRVQLSAAHEKAHLDKAILAFTEVGRELGVIS",
"proteome": "UP000013909",
"gene": "kbl",
"go_terms": [
{
"identifier": "GO:0030170",
"name": "pyridoxal phosphate binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008890",
"name": "glycine C-acetyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006567",
"name": "L-threonine catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016740",
"name": "transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "220d43766bfe69807874ea078bc783ea7854e968",
"counters": {
"domain_architectures": 344728,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"cdd": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 2,
"panther": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 344728
}
}
}