GET /api/protein/UniProt/R7ZLP9/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "R7ZLP9",
        "id": "R7ZLP9_9BACT",
        "source_organism": {
            "taxId": "1232681",
            "scientificName": "Lunatimonas lonarensis",
            "fullName": "Lunatimonas lonarensis"
        },
        "name": "2-amino-3-ketobutyrate coenzyme A ligase",
        "description": [
            "Catalyzes the cleavage of 2-amino-3-ketobutyrate to glycine and acetyl-CoA",
            "Involved in de novo bacterial ceramide synthesis. Catalyzes the condensation of L-serine with palmitoyl-CoA (hexadecanoyl-CoA) to produce 3-oxosphinganine. Also capable of using alanine as substrate leading to the formation of 1-deoxysphinganine (1-deoxySa). Contributes to the levels of endogenous sphingolipids in its host"
        ],
        "length": 398,
        "sequence": "MYDRLKPSLISELEDIQSAGLFKRERIILSPQGAEILVEGGKTVLNFCANNYLGLSSHPAVIEAAKQAIDSHGFGMSSVRFICGTQDIHKVLEQKISDFLGTEDTILYAAAFDANGGVFEPLFGPEDAIISDTLNHASIIDGVRLCKAMRFRYAHNDMADLERQLQEAVAKGAKQRIIVTDGVFSMDGTIAQLDKIVALAEKYEALVMSDECHSTGFVGKTGRGVHELTGVMGKLDIITGTLGKALGGASGGFTSGRKEIIELLRQRSRPYLFSNTLAPAIVGASNAVFDLLAASTDLRDKLEQNTLYFREQMTAAGFDIKPGIHPIVPIMLYDAALSQRMAEKLLEKGVYVIGFYYPVVPKGQARIRVQLSAAHEKAHLDKAILAFTEVGRELGVIS",
        "proteome": "UP000013909",
        "gene": "kbl",
        "go_terms": [
            {
                "identifier": "GO:0030170",
                "name": "pyridoxal phosphate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008890",
                "name": "glycine C-acetyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006567",
                "name": "L-threonine catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016740",
                "name": "transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "220d43766bfe69807874ea078bc783ea7854e968",
        "counters": {
            "domain_architectures": 344728,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 344728
        }
    }
}