"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9ZE09"	"{'domain_architectures': 22404, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 22404}"	"['Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity)']"	"gatC"	"[{'identifier': 'GO:0006450', 'name': 'regulation of translational fidelity', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"GATC_RICPR"	"18250786e3cb6183ae4d86d62ad3d105c32ab112"	True	False	False	100	"Glutamyl-tRNA(Gln) amidotransferase subunit C"	3	"UP000002480"	"MITKEEAQKIAKLARLKFEKDIVEKFSTQLSTIMNMINILNEIDCKDIEPLTSVSNMNARMREDTVTSSDLSNKLFDNVSGNSAKLAKEVKYFITPKVVE"	"reviewed"	"{'taxId': '272947', 'scientificName': 'Rickettsia prowazekii (strain Madrid E)', 'fullName': 'Rickettsia prowazekii (strain Madrid E)'}"