"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9R1B1"	"{'domain_architectures': 17178, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 17178}"	"['Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space']"	"Timm10b"	""	"T10B_RAT"	"f9178374a5901be0d54a7f9dfe55ffbddb0efa3a"	True	False	False	100	"Mitochondrial import inner membrane translocase subunit Tim10 B"	3	"UP000002494"	"MEHQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVHLMPALVQRRMADYEAASAVPGVPAEQPRDSPSGS"	"reviewed"	"{'taxId': '10116', 'scientificName': 'Rattus norvegicus', 'fullName': 'Rattus norvegicus (Rat)'}"