"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9NXA8"	"{'domain_architectures': 39229, 'entries': 14, 'isoforms': 4, 'proteomes': 1, 'sets': 2, 'structures': 26, 'taxa': 1, 'dbEntries': {'profile': 1, 'ssf': 1, 'cathgene3d': 2, 'cdd': 1, 'panther': 1, 'hamap': 1, 'pfam': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 39229}"	"['NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins (PubMed:21908771, PubMed:22076378, PubMed:24703693, PubMed:29180469). Activates CPS1 and contributes to the regulation of blood ammonia levels during prolonged fasting: acts by mediating desuccinylation and deglutarylation of CPS1, thereby increasing CPS1 activity in response to elevated NAD levels during fasting (PubMed:22076378, PubMed:24703693). Activates SOD1 by mediating its desuccinylation, leading to reduced reactive oxygen species (PubMed:24140062). Activates SHMT2 by mediating its desuccinylation (PubMed:29180469). Modulates ketogenesis through the desuccinylation and activation of HMGCS2 (By similarity). Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo. Can deacetylate cytochrome c (CYCS) and a number of other proteins in vitro such as UOX']"	"SIRT5"	"[{'identifier': 'GO:0036054', 'name': 'protein-malonyllysine demalonylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0036055', 'name': 'protein-succinyllysine desuccinylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0070403', 'name': 'NAD+ binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"SIR5_HUMAN"	"d025c4a47877c4dc4d451880aa4615a59586b83c"	True	False	310	"NAD-dependent protein deacylase sirtuin-5, mitochondrial"	1	"UP000005640"	"MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS"	"reviewed"	"{'taxId': '9606', 'scientificName': 'Homo sapiens', 'fullName': 'Homo sapiens (Human)'}"
