"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9LUJ3"	"{'domain_architectures': 736, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 5, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 736}"	"['Regulator of RNA-directed DNA methylation (RdDM). Binds to single-stranded methyl DNA. Involved in the assembly of RNA polymerase V (Pol V) transcription initiation or elongation complexes at the chromatin, as a component of the DDR complex']"	"RDM1"	"[{'identifier': 'GO:0080188', 'name': 'gene silencing by siRNA-directed DNA methylation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005634', 'name': 'nucleus', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RDM1_ARATH"	"d6b0e3b391ae9a613a0ceae752ccfab0fd580005"	True	False	False	163	"Protein RDM1"	1	"UP000006548"	"MQSSMTMELRPSGDSGSSDVDAEISDGFSPLDTSHRDVADEGSLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQLYGQPLHYLTNVLLQRWDQSRFGTDSEEQRLDSIIHPTKAEATIWLVEEIHRLTPSHLHMALLWRSDPMYHSFIDPIFPEK"	"reviewed"	"{'taxId': '3702', 'scientificName': 'Arabidopsis thaliana', 'fullName': 'Arabidopsis thaliana (Mouse-ear cress)'}"