"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9JJ57"	"{'domain_architectures': 13132, 'entries': 14, 'isoforms': 4, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 2, 'profile': 1, 'smart': 1, 'cdd': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 13132}"	"['Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels (PubMed:14572458). Regulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner (PubMed:14572458). Modulates KCND2/Kv4.2 currents (PubMed:14572458). In vitro, modulates KCND1/Kv4.1 currents (By similarity). Increases the presence of KCND2 at the cell surface']"	"Kcnip1"	"[{'identifier': 'GO:0005509', 'name': 'calcium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"KCIP1_MOUSE"	"6221f0aa6d2dc3551fc0774632a44e22f98a3949"	True	False	227	"A-type potassium channel modulatory protein KCNIP1"	1	"UP000000589"	"MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEETFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM"	"reviewed"	"{'taxId': '10090', 'scientificName': 'Mus musculus', 'fullName': 'Mus musculus (Mouse)'}"