General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9IA79",
        "id": "BI1_PAROL",
        "source_organism": {
            "taxId": "8255",
            "scientificName": "Paralichthys olivaceus",
            "fullName": "Paralichthys olivaceus (Bastard halibut)"
        },
        "name": "Probable Bax inhibitor 1",
        "description": [
            "Suppressor of apoptosis. Modulates unfolded protein response signaling. Modulate ER calcium homeostasis by acting as a calcium-leak channel (By similarity)"
        ],
        "length": 237,
        "sequence": "MNVFDRNINFDSLFKFSQISHSTQVHLKNVYSSLAVCMFVAAAGSYVHVVTRLFQGGMLSVLGSLGMMFWLAMTPHNSETEKKRLAILAGFAFLTGVGLCPTLDFVIAINPSIIVTAFLGTSVIFVCFTLSALYAKRRSYLFLGGTLMSGLSILFLMSMMNMFFGSVMLFKAHMYLGLLIMCGFVLXDTQLIIEKAENGDKDYVWHSVDLFLDFITIFRKLMVILALNDKDKKKEKK",
        "proteome": null,
        "gene": "tmbim6",
        "go_terms": [
            {
                "identifier": "GO:0043066",
                "name": "negative regulation of apoptotic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "ida_accession": "82455095b0854e5bcd1644042a3a2dd6ee243050",
        "counters": {
            "domain_architectures": 27277,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 27277
        }
    }
}