"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9CQY9"	"{'domain_architectures': 795, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 31, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 795}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"Ndufc1"	"[{'identifier': 'GO:0005739', 'name': 'mitochondrion', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0045271', 'name': 'respiratory chain complex I', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"NDUC1_MOUSE"	"f78686d7a584e7a44c1a867ff667615ef03abc50"	True	False	False	76	"NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial"	1	"UP000000589"	"MAPSVVLRSFSRLLAPARLPSCSSTRSKFYVREPVNAKPNWLAVGLSVGASVFMWIYLIQTHNEDVLEYKRRNGLE"	"reviewed"	"{'taxId': '10090', 'scientificName': 'Mus musculus', 'fullName': 'Mus musculus (Mouse)'}"