"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9BS18"	"{'domain_architectures': 2302, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 20, 'taxa': 1, 'dbEntries': {'pfam': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2302}"	"[""Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle (PubMed:15060174, PubMed:18485873). The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains (PubMed:15060174, PubMed:18485873). The APC/C complex catalyzes assembly of branched 'Lys-11'-/'Lys-48'-linked branched ubiquitin chains on target proteins (PubMed:29033132)""]"	"ANAPC13"	"[{'identifier': 'GO:0005680', 'name': 'anaphase-promoting complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"APC13_HUMAN"	"10264413fe49b2a99827108cd93d0baa95df056c"	True	False	False	74	"Anaphase-promoting complex subunit 13"	1	"UP000005640"	"MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN"	"reviewed"	"{'taxId': '9606', 'scientificName': 'Homo sapiens', 'fullName': 'Homo sapiens (Human)'}"