"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9BA03"	"{'domain_architectures': 51372, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 51372}"	"['Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I']"	"NADH-6"	"[{'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"Q9BA03_SIGGR"	"96cfd4c69773af29d548fde0c6c747d9cca5615a"	True	False	False	173	"NADH-ubiquinone oxidoreductase chain 6"	3	""	"MTYLVFLFLLVLVVGLVGVASNPTPYFAALGLVVAAGAGCGVLVGCGGSFLSLVLLLVYLGGMLVVFAYSAALAAEPHPESWGDWSVVGYVGGYMTGVVAGGGWLWGGWYESCWMMGDEFSESCVLRGDSSGVALMYFTGGEMLVVCVWVLLMTLFVVLELTRGVGRGSLRAV"	"unreviewed"	"{'taxId': '48457', 'scientificName': 'Sigmops gracilis', 'fullName': 'Sigmops gracilis (Slender fangjaw)'}"
