"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q972B1"	"{'domain_architectures': 27502, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'ncbifam': 3, 'pirsf': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 27502}"	"['DNA-dependent RNA polymerase (RNAP) catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates']"	"rpo6"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003899', 'name': 'DNA-directed RNA polymerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006351', 'name': 'DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"RPO6_SULTO"	"e86b40bc3674d898b799b1be30e5ef4e4a4b7a40"	True	False	False	86	"DNA-directed RNA polymerase subunit Rpo6"	3	"UP000001015"	"MSINKIFEESWKNRLTKYEIARIISARALQLAMGASPLIDTNNLPFNDVISIAEEELKRGVLPITVRRVYPNGKIELVSVKKVEFK"	"reviewed"	"{'taxId': '273063', 'scientificName': 'Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)', 'fullName': 'Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)'}"