"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q91RE0"	"{'domain_architectures': 1899, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 1899}"	"['Non catalytic polymerase cofactor and regulatory protein that plays a role in viral transcription and replication. Stabilizes the RNA polymerase L to the N-RNA template and binds the soluble protein N, preventing it from encapsidating non-genomic RNA. Also inhibits host IFN-alpha and IFN-beta signaling by binding and retaining phosphorylated STAT1 in the cytoplasm or by inhibiting the DNA binding of STAT1 in the nucleus']"	"P"	"[{'identifier': 'GO:0003968', 'name': 'RNA-directed RNA polymerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019083', 'name': 'viral transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q91RE0_MOKV"	"a28768b8afa9796f7573a4ee0423680fff7e371e"	False	False	False	303	"Phosphoprotein"	3	""	"MSKDLVHPSLIRAGIVDLEMAEETTDLINRTIEGNQAHLQGEPFDVDSLPEDMSRLKIRGESGKAKAEEEERDEGSSEEDDYLSDRQNPLVLFQNFLDDIGAKAVKKLKTGEGFFRVWSALSDDIKGYVSTNLMPSNARKTKSVQIQTEPTTLSSFASESRPDSWCMQDQKDKEDHTTDHDMVSDVESATEKEEIRDIEGEVAHQVAESFSKKYKFPSRSSGIFLWNFEQLKMNLDDIVKAAMNVPGVDMIAEKGGKLPLRCILGFVALDSSKRFRLLANNDKVARLIQDDINSYMARLEEAD"	"unreviewed"	"{'taxId': '12538', 'scientificName': 'Mokola virus', 'fullName': 'Mokola virus (MOKV)'}"