"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8ZVI1"	"{'domain_architectures': 2064, 'entries': 18, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 1, 'taxa': 1, 'dbEntries': {'pfam': 2, 'ssf': 2, 'cathgene3d': 2, 'cdd': 1, 'hamap': 1, 'pirsf': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2064}"	"[""Endonuclease that removes tRNA introns. Cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. Recognizes a pseudosymmetric substrate in which 2 bulged loops of 3 bases are separated by a stem of 4 bp""]"	"endA"	"[{'identifier': 'GO:0000213', 'name': 'tRNA-intron lyase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006388', 'name': 'tRNA splicing, via endonucleolytic cleavage and ligation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"ENDA_PYRAE"	"941abee8bd23336a20187cbb8cd57119e9ef0738"	True	False	False	183	"tRNA-splicing endonuclease"	1	"UP000002439"	"MIGYLRGLAVIVEDVEFARRLYKEGFYGRFLGYDKVKRDEVEKINAPLILGLYEALYLAEKGRLKVMGEDGREVAPEELAALGRERMRNFDEIYKIYKYFRDLGYVVKSGLKFGALFSVYEKGPGIDHAPMVVVFLEPDKGISATDITRGGRLSHSVRKTWTLATVLRQTGEVVLLGFGWARL"	"reviewed"	"{'taxId': '178306', 'scientificName': 'Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)', 'fullName': 'Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)'}"