"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8Z7S0"	"{'domain_architectures': 3202, 'entries': 22, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'pfam': 2, 'profile': 1, 'cdd': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prints': 2, 'prosite': 1, 'interpro': 8}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3202}"	"['With TolR probably plays a role in maintaining the position of the peptidoglycan cell wall in the periplasm. Acts as a porin with low permeability that allows slow penetration of small solutes; an internal gate slows down solute passage', 'Required for conjugation with F-type plasmids; probably serves as the mating receptor on recipient cells']"	"ompA"	"[{'identifier': 'GO:0009279', 'name': 'cell outer membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0015288', 'name': 'porin activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"OMPA_SALTI"	"88ba11a7c22d2e5b7750c9e3f2664a237e38bd34"	True	False	False	350	"Outer membrane protein A"	3	"UP000002670"	"MKKTAIAIAVALAGFATVAQAAPKDNTWYAGAKLGWSQYHDTGFIHNDGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNTNGAYKAQGVQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPVFAGGIEYAITPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRFGQQEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGVKDVVTQPQA"	"reviewed"	"{'taxId': '90370', 'scientificName': 'Salmonella typhi', 'fullName': 'Salmonella typhi'}"
