GET /api/protein/UniProt/Q8YUT1/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q8YUT1",
"id": "GVPJ_NOSS1",
"source_organism": {
"taxId": "103690",
"scientificName": "Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)",
"fullName": "Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)"
},
"name": "Gas vesicle protein J",
"description": [
"A minor component of the gas vesicle, might be involved in nucleating gas vesicle formation (By similarity). Gas vesicles (GV) are hollow, gas filled proteinaceous nanostructures. During planktonic growth they allow positioning of the organism at a favorable depth for light or nutrient acquisition (By similarity)",
"Cluster expression in E.coli (gvpA1-gvpA2-gvpC-gvpN-gvpJ-gvpK-gvpF-gvpG-gvpV-gvpW) allows cells to float and produces irregularly shaped gas vesicles"
],
"length": 148,
"sequence": "MTTTPIHPTRPQTNSNRVIPTSTQGSTLADILERVLDKGIVIAGDISISIASTELIHIRIRLLISSVDKAREMGINWWENDPYLSSKSQRLVEENQQLQQRLESLETQLRLLTSAAKEETTLTANNPEDLQPMYEVNSQEGDNSQLEA",
"proteome": null,
"gene": "gvpJ",
"go_terms": [
{
"identifier": "GO:0005198",
"name": "structural molecule activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0012506",
"name": "vesicle membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d85297803be73a3ff23f7d80f67bba44094dd074",
"counters": {
"domain_architectures": 7438,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 7438
}
}
}