"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8WHB5"	"{'domain_architectures': 6678, 'entries': 2, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 6678}"	"['NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient']"	"ndhF"	""	"Q8WHB5_9LAMI"	"45253de4147b7500695ba341816967ce01ad8d3c"	True	False	True	88	"NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic"	3	""	"FAIIAWATAGLTAFYMFRIYLLTFEGHLNVNLKNYSGSQNAPLYSLSPWGKGCSKRINKNFRLLRMNNNERSSFFSKTTYRSDDNVRK"	"unreviewed"	"{'taxId': '133313', 'scientificName': 'Camptoloma canariense', 'fullName': 'Camptoloma canariense'}"
