"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8WAZ2"	"{'domain_architectures': 86317, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cdd': 1, 'profile': 2, 'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 86317}"	"['Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis']"	"cytb"	"[{'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0022904', 'name': 'respiratory electron transport chain', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q8WAZ2_ANARE"	"be34220e9275984b10f29960f25876d49b60ca7d"	True	False	True	218	"Cytochrome b"	4	""	"LFLAMHYTADTSMAFSSVAHICRDVNNGWLLRNLHANGASFFFICIYLHIGRGMYYGSYLFKETWNIGVILLFLVMATAFVGYVLPWGQMSFWGATVITNLLSAAPYIGTELVQWIWGGFSVDNATLTRFFTFHFILPFIIAGASMLHLLFLHQTGSSNPTGLNSNFDKIPFHVYFSYKDVLGFAIMLALLALLSTFAPNLLGDPDNFTPANPLVTPP"	"unreviewed"	"{'taxId': '47555', 'scientificName': 'Anaxyrus retiformis', 'fullName': 'Anaxyrus retiformis (Sonoran green toad)'}"