General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8R2U2",
        "id": "RMP64_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Nucleolus and neural progenitor protein",
        "description": [
            "Specific component of the MRP ribonucleoprotein endoribonuclease, Rnase/Mrp complex, a ribonucleoprotein complex involved in pre-rRNA processing (By similarity). May play a role in cortex development as part of the Notch signaling pathway. Downstream of Notch may repress the expression of proneural genes and inhibit neuronal differentiation thereby maintaining neural progenitors. May also play a role in preimplentation embryo development (PubMed:19906856, PubMed:26178919)"
        ],
        "length": 564,
        "sequence": "MAAAVRPGAEPWNRVRIPQAGNCSTLTVRDPSATLDICTAAVTKGCHLVTQSLKSQTLDAEVDVLCSVLYSNHNRLGHHKPHLALRQVEQCLKRLKHMNLEGSIEDLSQLLSANATQPGATENRVVPSQPVVEVVLMKVLGGCKLLLRLLDCCCKAFLLTVKHLGLKEFIILNLVMVGLVSRLWVLHKGLLRRLISLYEPLLSLRQEISSIHPMPYFKDFAFPSDITDFLGPSYLEVFKVKTPAASATKGVTKLLNKLFLMREQLPKMNEDTLDRLSKPSEQMTSNPQSTVDLGQPVKACKRTRKEKPLGFDLRAFCTRLGNKATQETNRDFKYSQSKLKTTKLPSQQLRTHWANDTVQRIRKTKTFAQLSEEIEMAIVWSRSKKLKTQATFLGNKLLKSNRFRHVESQGYSLTKKLQCMKTSLCNCLLRGSRTSTSEHPPRQRRSKYKVLSRQRKPQRKLQSTLLKETQQVPEGTLKNTRDSSAKRRCSGTVQRSDVCPNGKQVLRKLAKPDLKTKVVVHGNLTGGSRNESGFQAKTQMHTHNAPDTAKEADDIDDIFALMGV",
        "proteome": "UP000000589",
        "gene": "Rmp64",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "597d69ca282215898c76950a27421cf229753d3c",
        "counters": {
            "domain_architectures": 2154,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2154
        }
    }
}