General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8MVC4",
        "id": "TFPIL_IXOSC",
        "source_organism": {
            "taxId": "6945",
            "scientificName": "Ixodes scapularis",
            "fullName": "Ixodes scapularis (Black-legged tick)"
        },
        "name": "Penthalaris",
        "description": [
            "Anticoagulant protein that inhibits the activation of host coagulation factors Xa (F10) and IXa (F9) by the factor VIIa-tissue factor (F7-F3) complex (PubMed:15116248). Does not inhibit the amidolytic activity of thrombin (F2), factor Xa (F10), trypsin and elastase (PubMed:15116248)"
        ],
        "length": 330,
        "sequence": "MQRNILWISVVAAFGVFHFGECTYQDSGEDSSSMTEESRCDGPPHASRGLMNIPGWFYDGSRDQCRRYHFPDQQFDMAKNKFKTVTECRKSCRSTVPLQCFKKPPQTIRTMGLPVSTYNSTQGECVTIAVRPGQTGPNIFRREVECNETCRDPEYGKCAPLHIVDCGGSTGNHYNLDKQTCEKTTKNKCGPFATLEDCFKRCARYIQRKCNIPLLKSEYCDIVDLRYWYNSESKQCEEIMGCADDVYNFPTAKECWETCSSKEESRCLQPPDLGKLGIGRTRYYYNITSNRCLTTTHVAFWQNTEKKNNFKRRSDCENTCRPKHKDVKKL",
        "proteome": "UP000001555",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0004867",
                "name": "serine-type endopeptidase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "da1dbef7474dfb931949807831ef35abc3444b1c",
        "counters": {
            "domain_architectures": 2221,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "smart": 1,
                "profile": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2221
        }
    }
}