"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8KA49"	"{'domain_architectures': 27664, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'pfam': 1, 'cdd': 1, 'ncbifam': 1, 'panther': 1, 'prints': 1, 'prosite': 2, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 27664}"	"['General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the PTS EIIA domain']"	"ptsH"	""	"PTHP_BUCAP"	"949e40f21cba13b01845a0586f640aa7a6558887"	True	False	False	85	"Phosphocarrier protein HPr"	3	"UP000000416"	"MFQKEIKINALHGLHTRPAAEFVKEAKNFISDIHIIYHGKSVNAKSLFKIQTLGLVKDSVIILSAEGEDEKKAVEHLSKIMTELE"	"reviewed"	"{'taxId': '198804', 'scientificName': 'Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)', 'fullName': 'Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)'}"
