"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8EIG5"	"{'domain_architectures': 10481, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 2, 'pfam': 2, 'profile': 1, 'ncbifam': 2, 'hamap': 1, 'panther': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 10481}"	"['Transcription factor that acts by binding directly to the RNA polymerase (RNAP). Required for negative regulation of rRNA expression and positive regulation of several amino acid biosynthesis promoters. Also required for regulation of fis expression']"	"dksA"	"[{'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"Q8EIG5_SHEON"	"d82a727f4c8057974f0fbd75da7dd8cbf42afb9b"	True	False	False	147	"RNA polymerase-binding transcription factor DksA"	3	"UP000008186"	"MPEGTKKLGVLAIAGVSPYQEKPGEEYMNAKQLGHFKTILEAWRNQLREEVDRTLSHMQDEAANFPDPVDRAAQEEEFSLELRARDRERKLIKKIEKTLQKIEEDDFGFCDSCGIEIGIRRLEARPTADQCIDCKTLAEIKEKQMAG"	"unreviewed"	"{'taxId': '211586', 'scientificName': 'Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)', 'fullName': 'Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)'}"
