"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8DS28"	"{'domain_architectures': 32310, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'pirsf': 1, 'hamap': 1, 'ncbifam': 1, 'prosite': 1, 'prints': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 32310}"	"['This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center']"	"rplF"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019843', 'name': 'rRNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RL6_STRMU"	"c01b5e597917fe4c7fa771044375a52b35f2e850"	True	False	False	178	"Large ribosomal subunit protein uL6"	3	"UP000002512"	"MSRIGNKVITLPAGVEVTNKDNVVTVKGPKGELTREFPKVIEIKIEGTEVTLHRPNDSKEMKTIHGTARANLNNMVIGVSEGFKKELEMRGVGYRAQLQGKKLVLSVGKSHPDEVEAPEGITFEVPTATAIVVNGINKEVVGQTAAYIRGLRVPEPYKGKGIRYAGEYVRRKEGKTGK"	"reviewed"	"{'taxId': '210007', 'scientificName': 'Streptococcus mutans serotype c (strain ATCC 700610 / UA159)', 'fullName': 'Streptococcus mutans serotype c (strain ATCC 700610 / UA159)'}"