"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8BMG8"	"{'domain_architectures': 140476, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'pfam': 1, 'ssf': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 140476}"	"['Facilitates flavin adenine dinucleotide (FAD) translocation across the mitochondrial inner membrane into the mitochondrial matrix where it acts as a redox cofactor to assist flavoenzyme activities in fundamental metabolic processes including fatty acid beta-oxidation, amino acid and choline metabolism as well as mitochondrial electron transportation. In particular, provides FAD to DLD dehydrogenase of the glycine cleavage system, part of mitochondrial one-carbon metabolic pathway involved in neural tube closure in early embryogenesis']"	"Slc25a32"	"[{'identifier': 'GO:0006862', 'name': 'nucleotide transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0055085', 'name': 'transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"S2532_MOUSE"	"e037822792ef5f5d7967370632f8bf737b916266"	True	False	False	316	"Solute carrier family 25 member 32"	1	"UP000000589"	"MTGQGQSAAGSAAWSAVFRHVRYENLVAGVSGGVLSNLALHPLDLVKIRFAVSDGLEVRPKYKGILHCLATIWKVDGLRGLYQGVTPNVWGAGLSWGLYFFFYNAIKSYKTEGRAEQLEPLEYLVSAAEAGAMTLCITNPLWVTKTRLMLQYGGVASPSQRQYKGMFDALVKIYKYEGVRGLYKGFVPGLFGTSHGALQFMAYELLKLKYNKHINRLPEAQLSTAEYISVAALSKIFAVAATYPYQVVRARLQDQHVSYGGVTDVITKTWRKEGIGGFYKGIAPNLIRVTPACCITFVVYENVSHFLYDLREKKVS"	"reviewed"	"{'taxId': '10090', 'scientificName': 'Mus musculus', 'fullName': 'Mus musculus (Mouse)'}"