"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q899S4"	"{'domain_architectures': 25900, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cdd': 1, 'panther': 1, 'ncbifam': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 25900}"	"['Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids folding of multispanning membrane proteins (By similarity)']"	"yidC"	"[{'identifier': 'GO:0032977', 'name': 'membrane insertase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"YIDC_CLOTE"	"355667fd3acb48492518bd521ca7a02a45d9f427"	True	False	False	220	"Membrane protein insertase YidC"	3	"UP000001412"	"MSHLNNALVEFFVIIHKFISSIITNPNYSYGVAIIFVTLIIKLILLPLNIKSMRSTIRINEIQPEIQKIQKKYKNDPQRLQQEQMKLYKEYNINPFGSCLPLLLQWPILIALYYVFNNIQGISGVSFLWVKDLASPDIVLAVLAGATQYYSGLLMNPKGDNTQAKTASNMNLSMSIMMIFISSRLKAALVIYWVTGNLIQMGQTILTKKLEQKHSANKDA"	"reviewed"	"{'taxId': '212717', 'scientificName': 'Clostridium tetani (strain Massachusetts / E88)', 'fullName': 'Clostridium tetani (strain Massachusetts / E88)'}"