"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q864J7"	"{'domain_architectures': 11561, 'entries': 15, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'ssf': 1, 'cathgene3d': 1, 'smart': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'prints': 3, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 11561}"	"['G protein-coupled receptor that binds melanocyte-stimulating hormones (alpha, beta, and gamma-MSH) and adrenocorticotropic hormone/ACTH, which are peptide products of the POMC precursor protein. Upon activation, MC1R couples with the G(s) protein, stimulating adenylate cyclase and activating the cAMP-dependent signaling pathway. This activation promotes melanogenesis, resulting in the production of eumelanin (black/brown) and pheomelanin (red/yellow) in melanocytes. MC1R interacts with G protein-coupled receptor opsin 3/OPN3, which couples to G(i) proteins and inhibits the alpha-MSH-induced cAMP response, thereby reducing melanin synthesis (By similarity). Binding to Agouti/ASP precludes alpha-MSH-induced signaling, thereby downregulating melanogenesis (By similarity). Additionally, interaction with MGRN1 displaces the G(s) protein, further suppressing MC1R signaling (By similarity)']"	"MC1R"	"[{'identifier': 'GO:0004930', 'name': 'G protein-coupled receptor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0007186', 'name': 'G protein-coupled receptor signaling pathway', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0004977', 'name': 'melanocortin receptor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004980', 'name': 'melanocyte-stimulating hormone receptor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"MSHR_MACSL"	"5040ebb238de8327affa8e634607f69b286b63d6"	True	False	False	317	"Melanocyte-stimulating hormone receptor"	3	""	"MPVQGSQRRLLGSLNSTPTATPHLGLAANQTGARCLEMSIPDGLFLSLGLVSLVENVLVVTAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVTLLLEAGALAARAAVVQQLDNVIDVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAIAAIWVASVLCSTLFIAYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRLAHQGFGLKGAATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAFRSQELRRTLKEVLLCSW"	"reviewed"	"{'taxId': '54601', 'scientificName': 'Macaca silenus', 'fullName': 'Macaca silenus (Lion-tailed macaque)'}"