"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q81AU5"	"{'domain_architectures': 35219, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 35219}"	"['Involved in bacillithiol (BSH) biosynthesis. Catalyzes the second step of the pathway, the deacetylation of N-acetylglucosaminylmalate (GlcNAc-Mal) to glucosamine malate (GlcN-Mal). Has weak activity compared with bshB1']"	"bshB2"	""	"BSHB2_BACCR"	"020005dfa17b4122b45278364089222e1b029606"	True	False	220	"Probable N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 2"	1	"UP000001417"	"MERHVLVVFPHPDDEAYAAGGTIRLLTDQGVPVTYACGTLGQMGRNMGKNVFANRETIPHIRKKELKDACEAMGIKDLRMLGFHDKTLEFEDVDFVADKIEAIIQEVNPSRIITFYPEHGVHPDHNAFGRAVVRAVSRMPKEERPVIHAVAITKNREAVLGEPDVVNNISEVFDHKLTALGAHRSQTEAMLEDTHAKIKNKDAATLKWLQLEQFWTYKWE"	"reviewed"	"{'taxId': '226900', 'scientificName': 'Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)', 'fullName': 'Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)'}"