General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q805F7",
        "id": "DIDA_AGKCO",
        "source_organism": {
            "taxId": "8713",
            "scientificName": "Agkistrodon contortrix contortrix",
            "fullName": "Agkistrodon contortrix contortrix (Southern copperhead)"
        },
        "name": "Disintegrin acostatin-alpha",
        "description": [
            "Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits ADP-induced platelet aggregation in human platelet-rich plasma"
        ],
        "length": 111,
        "sequence": "MIQVLLVTLCLAVFPYQGSSIILESGNVNDYEVVYPRKVTALPKGAIQPKNPCCDAATCKLTPGSQCAEGLCCDQCKFIKAGKICRRARGDNPDYRCTGQSGDCPRKHFYA",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "b30dbf931bc20efa7c46e26a9df409d4fcbe9c86",
        "counters": {
            "domain_architectures": 320,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "profile": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 320
        }
    }
}