"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q7VJ06"	"{'domain_architectures': 40505, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 2, 'cdd': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'pfam': 1, 'prosite': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 40505}"	"['Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit']"	"rplT"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019843', 'name': 'rRNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RL20_HELHP"	"dd0106d2fa935591bf6db4691453259ee8aeb0c1"	True	False	False	117	"Large ribosomal subunit protein bL20"	3	"UP000002495"	"MRVKTGVVRRRRHKKILKLARGFYSGRRKHFRKAKEQLERSMCYAFRDRKQKKRDFRRLWITRINAACKMNGVSYSRFIHALKLANIELDRKTLADMAMNDINAFNAVLASVKNKLK"	"reviewed"	"{'taxId': '235279', 'scientificName': 'Helicobacter hepaticus (strain ATCC 51449 / 3B1)', 'fullName': 'Helicobacter hepaticus (strain ATCC 51449 / 3B1)'}"
