"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q7QJE5"	"{'domain_architectures': 887312, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'ssf': 1, 'pfam': 1, 'cathgene3d': 2, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 887312}"	"[""Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. TP53RK has ATPase activity in the context of the EKC/KEOPS complex and likely plays a supporting role to the catalytic subunit OSGEP. Atypical protein kinase that phosphorylates 'Ser-15' of p53/TP53 protein and may therefore participate in its activation""]"	"1269747"	"[{'identifier': 'GO:0004672', 'name': 'protein kinase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006468', 'name': 'protein phosphorylation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0004674', 'name': 'protein serine/threonine kinase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"Q7QJE5_ANOGA"	"726173b0dde7bbc50c5d845a39c992d18faf18f3"	True	False	False	242	"non-specific serine/threonine protein kinase"	3	"UP000007062"	"MAVAVEKQEPVQQLLKQGAEGKLYIGTYKGNRCLVKERFEKKYRHPALDRQLTRQRIKAEQKAFQRCAAAGLSTPALYGVDLEQRKIYMEYLERSRTAKEFIDELTATTAADALQESAQLKQLAEQIGHMVGVLHRNNLVHGDLTTSNMLLDPVEKGAEESVFPYRLVTIDFGLSHFSDNHENKGVDLYVLERAILSAHSQLPGLFGMILEAYREHNTNHCKETIAKYEEVRARGRKRTMVG"	"unreviewed"	"{'taxId': '7165', 'scientificName': 'Anopheles gambiae', 'fullName': 'Anopheles gambiae (African malaria mosquito)'}"